PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01001304G0330
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family GRF
Protein Properties Length: 170aa    MW: 18478 Da    PI: 9.7106
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01001304G0330genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC76.33.1e-2481125145
              WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                      ++epgrCrRtDGKkWRC+r++++++k+CErH+hrgr+r  + ++e
  PH01001304G0330  81 EPEPGRCRRTDGKKWRCWRNAIPNEKYCERHMHRGRKRPVQLVVE 125
                      69************************************9998875 PP

2QLQ55.32e-191550237
              QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                     aFTa+Qlq+L++Q  +y+y+aa++PvP +L+++i+k
  PH01001304G0330 15 AFTAMQLQELEQQSRVYQYMAARVPVPTHLVFPIWK 50
                     8**********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009514.7E-81450IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166620.9221550IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088803.1E-121549IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166722.9781125IPR014977WRC domain
PfamPF088793.1E-2082120IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 170 aa     Download sequence    Send to blast
MKALVASVPA DAGAAFTAMQ LQELEQQSRV YQYMAARVPV PTHLVFPIWK SVTGASSEGA  60
QKYPTLMGLA TLCLDFGKNP EPEPGRCRRT DGKKWRCWRN AIPNEKYCER HMHRGRKRPV  120
QLVVEDDEPD SASGSKSASG KATEGGKKTD DKSSSSKKLA VAAPAAVEST
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0991680.0FP099168.1 Phyllostachys edulis cDNA clone: bphylf034g02, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006657676.11e-120PREDICTED: growth-regulating factor 11
SwissprotQ6AWX81e-121GRF11_ORYSJ; Growth-regulating factor 11
TrEMBLA0A0E0LKD21e-120A0A0E0LKD2_ORYPU; Uncharacterized protein
STRINGOB07G19720.11e-120(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP67353152
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.12e-31growth-regulating factor 5